PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID snap_masked-scaffold21955-abinit-gene-0.0-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family SRS
Protein Properties Length: 91aa    MW: 10009.5 Da    PI: 11.3323
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
snap_masked-scaffold21955-abinit-gene-0.0-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702108.51.1e-33481378
                                            DUF702  3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaa 65
                                                      +g   C+dCGn+akkdC+h+RCRtCCk+rgfdC+thv+stWvpaa+rrer+  +   +s+   
  snap_masked-scaffold21955-abinit-gene-0.0-mRNA-1  4 NGMRVCKDCGNRAKKDCSHRRCRTCCKTRGFDCSTHVRSTWVPAARRRERKMLMVGGASTIGG 66
                                                      56779*********************************************8776655544443 PP

                                            DUF702 66 sa..aeaaskrkrel 78
                                                       +  +++  kr+r++
  snap_masked-scaffold21955-abinit-gene-0.0-mRNA-1 67 GSsgSSSGVKRTRSN 81
                                                      332355556666654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.7E-30781IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016234.8E-26850IPR006510Zinc finger, lateral root primordium type 1
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MVENGMRVCK DCGNRAKKDC SHRRCRTCCK TRGFDCSTHV RSTWVPAARR RERKMLMVGG  60
ASTIGGGSSG SSSGVKRTRS NPKKEFGLLN N
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015383305.18e-31PREDICTED: protein LATERAL ROOT PRIMORDIUM 1
RefseqXP_006470561.18e-31PREDICTED: protein LATERAL ROOT PRIMORDIUM 1
RefseqXP_006470560.18e-31PREDICTED: protein LATERAL ROOT PRIMORDIUM 1
SwissprotQ9SD403e-25SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLV4TGL82e-30V4TGL8_9R
TrEMBLA0A067EV992e-30A0A067EV99_CITSI; Uncharacterized protein (Fragment)
STRINGGLYMA02G44860.23e-27(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2530023
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36260.11e-27Lateral root primordium (LRP) protein-related